American Journal of Plant Sciences, 2012, 3, 1640-1645
http://dx.doi.org/10.4236/ajps.2012.311199 Published Online November 2012 (http://www.SciRP.org/journal/ajps)
Observation on Baseline Sensitivity of Erysiphe necator
Genetic Groups to Azoxystrobin
Hajaj Ramadan Hajjeh
Faculty of Agricultural Science and Technology, Palestine Technical University-Kadoori (PTUK), Tulkarm, Palestine.
Email: h.hajjeh@ptuk.edu.ps
Received August 10th, 2012; revised September 17th, 2012; accepted October 15th, 2012
ABSTRACT
Powdery mildew, caused by Erysiph necator, is a common and severe fungal disease of grapevine all over the world.
The disease costs millions of dollars to vine growers, due to intensive use of fungicides and yield losses. Recently in
population of E. necator two genetic groups have been described, the two groups seem to occupy different temporal
niches, with a temporal alternation that is clear-cut in vineyards intensively treated with chemical fungicides. QoI-
STAR (Quinol Outside Inhibitors-Strobilurin Type of Action and Resistance) fungicides are widely used to control the
disease, and generally carry a high risk of pathogen resistance development. To clarify the behaviors of the biotrophic
fungus when treated with azoxystrobin as a representative of QoI-STAR, baseline sensitivity of laboratory isolates were
determined. A leaf bioassay and the primers RSCBF1 and RSCBR2 designed on the highly conserved regions of cytb
gene in fungi were used. Partial sequence of E. necator cytb gene were obtained. Attempts to obtain a laboratory mutant
were not totally successful. The sensitivity to azoxystrobin (EC50) in isolates of genetic group B was significantly
higher than in isolates of group A, to which all the isolates collected later in the season belonged. The higher sensitivity
to azoxystrobin fungicides observed in group B isolates can be at the basis of their precocious disappearance in vine-
yards, and can have important implications for powdery mildew control strategies.
Keywords: Powdery Mildew; Fungicide Sensitivity; QoI-STAR Fungicide; Genetic Groups; cytb Gene
1. Introduction
Powdery mildew, caused by the obligate fungus Erysiphe
necator Schw., is a common and severe fungal disease of
grapevine worldwide, due to the high adaptability of the
pathogen to different climatic conditions. In populations
of the fungus, two genetic groups or biotypes corre-
sponding to the different overwintering forms have been
described (quiescent mycelium in buds, “flag shoot” bio-
type (group A) and cleistothecia, “ascospore” biotype
(group B) [1]. Alternation of the two groups is clear-cut
evidence in vineyards intensively treated with chemical
fungicides, where group B isolates can persist throughout
the season [1]. Thus, changes in the composition of fun-
gal populations might be influenced by spray schedules
as a result of different sensitivity to fungicides [2].
Control of the disease is exclusively depending on in-
tensive application of fungicides. Quinol Outside Inhibi-
tors-Strobilurin Type of Action and Resistance (QoI-
STAR) fungicides are one of the most important class of
agricultural fungicides that are widely used to control
grapevine powdery mildew. These fungicides inhibit
mitochondrial respiration at the ubiquinol oxidation cen-
tre (Qo site) of the cytochrome bc1 enzyme complex
(complex III) [3]. Because of their single-site mode of
action, QoI fungicides generally carry a high risk of patho-
gen resistance in more than 30 phytopathogenic species,
such as casual agent of powdery mildews, downy mil-
dews, anthracnose, scab, and grey mould [4].
Two mechanisms of resistance to QoI fungicides are
known. The first involves one or several point mutations
in the cytb gene, resulting in changes of the peptide se-
quence preventing fungicide binding [5]. Single or com-
bined point mutations in the cytochrome b gene (cytb)
were detected in many fungi at amino acid position 127
to 147 and 275 to 296 [6,7]. Substitution of glycine with
alanine at position 143 (G143A) was described to be as-
sociated with the expression of high resistance, while
substitution of glycine to arginine at position 137
(G137R) and substitution of phenylalanine to leucine at
position 129 (F129L) are associated with the low resis-
tance [4,8]. The second mechanism was observed in vitro
and involves’s the activity of alternative oxidase (AOX)
enzyme, which oxidise ubiquinone and reduce oxygen to
water by bypassing the QoI-induced block in the electron
transport chain allowing growth [7,9,10].
Copyright © 2012 SciRes. AJPS
Observation on Baseline Sensitivity of Erysiphe necator Genetic Groups to Azoxystrobin 1641
Field resistance to QoI fungicides in E. necator popu-
lation was detected in USA, several European countries
and Australia [11,12]. It has been confirmed that the
G143A mutation in cytb confers QoI resistance in E. ne-
cator [13,14].
The development of suitable monitoring techniques
and effective anti-resistance strategies are crucial to
maintain effectiveness of QoI fungicides. The objective
of the present work is to determine the baseline sensitive-
ity and resistance of E. necator genetic groups to azox-
ystrobin fungicides at molecular level.
2. Materials and Methods
2.1. Fungal Isolates
The fungal isolates used in this study were obtained from
the characterized collection at University of Bari [1]. In
vitro grapevine leaves production and maintenance of the
fungal isolates were carried out as described by Miazzi et
al. (1997) [15].
2.2. Bioassay of Fungicide Sensitivity
Commercial formulations of the QoI fungicides, azox-
ystrobin (Quadris, Syngenta), were used. Fungicides
were suspended in autoclaved water containing 0.05%
tween 20 (Sigma, USA) at final concentrations of 0.1, 0.3,
1, 3, and 6 μg·ml−1 of active ingredient.
In vitro produced grape leaves of cv. “Baresana” were
used to assess the sensitivity of E. necator isolates to
fungicides [2]. Leaves were standardized in age and size
to minimize any possible influence of such factors on the
growth of E. necator colonies.
Application of fungicides was carried out by dipping
leaves in fungicide suspensions at appropriate concentra-
tion containing 0.05% tween 20 for 1 min under gentle
shaking. Control experiments were conducted by im-
mersing leaves in sterile distilled water containing 0.05%
Tween 20. Leaves were then placed in 55-mm-diam Petri
dishes containing 10 ml of B0/2 substrate as described by
Miazzi et al. (1997) [15]. Petri dishes were left closed in
a laminar flow cabinet for 8 h before inoculation. Each
leaf was then inoculated at single point with about 15 -
20 conidia under a stereomicroscope at 50× magnifica-
tion. Inoculated leaves were then kept in a growth cham-
ber at 21˚C ± 1˚C and exposed, 16 hours per day, to the
light produced by a combination of 3 Osram L36W Cool
White lamps and 3 Silvanya Grolux F36W lamps.
After two weeks, diameter of fungal colonies was
measured with the aid of stereomicroscope. The effective
concentration at 50% (EC50) was calculated for individ-
ual isolates. Resistance factor (RF) was calculated ac-
cording to the formula RF = EC50 for the resistant isolate/
EC50 of sensitive isolates.
2.3. Molecular Biology Assay
The primers RSCBF1 and RSCBR2, designed by Ishii et
al. (2001) [16] on the ground of highly conserved regions
of cytb gene in fungi and proved specific for the cytb
gene in Sphaeroteca fusca, were used.
DNA was extracted from mycelium and conidia with
InstaGene Matrix (Bio-Rad Laboratories, USA). PCR
was performed in 25 l reaction mixtures containing 50
ng of total DNA, 2 mM MgCl2, 200 M each dNTP
(Promega, Madison, WI, USA); 10 mM Tris-HCl, pH 8.3;
50 mM KCl; 0.1% gelatin, and 1 U of Red Taq DNA
polymerase (Sigma, St Louis, Missouri, USA). PCR
reactions were performed in a thermal cycler (Gene Amp
PCR System 9700; Perkin-Elmer, Norwalk, USA) pro-
grammed as follow: 4 min at 94˚C, followed by 40 cycles
of 30 sec at 94˚C, 1 min at 52˚C, 1.5 min at 72˚C, and a
final extension stage of 7 min at 72˚C [16]. PCR products
were separated on 2% agarose gel (Bio-Rad Laboratories,
USA) in 0.5× TBE buffer (45 mM Tris-borate, 1 mM
Na-EDTA; pH 8) at 110 V for 120 min (Sub-Cell TM,
Bio-Rad Laboratories, USA), The gal was stained with 1
μg·ml−1 ethidium bromide for 10 min and the bands were
recovered by mechanical excision of small gel plugs.
DNA fragments were eluted, purified using the Qiaex II
Gel Extraction Kit (QIAGEN, Germany) and sequenced
by MWG Biotech (Italy).
2.4. Generation of Azoxystrobin Resistant
Putative Mutants
Mono-conidial cultures of the G82 isolate, were grown in
vitro grapevine leaves treated with azoxystrobin. At 1-
month intervals, colonies were sub-cultured on leaves
treated with increasing concentrations (0.1, 1, 5, 10 and
20 μg·ml−1) of the fungicide. After that cultures were
maintained on leaves treated with 10 or 20 μg·ml−1
azoxystrobin.
3. Results
Twenty E. necator isolates representative of the tow ge-
netic groups (Table 1), were used to establish baseline
sensitivity to azoxystrobin. EC50 values ranged from less
than 0.1 to 0.3 μg·ml−1 azoxystrobin. Colony growth was
inhibited at 0.1 to 6 μg·ml−1 of the fungicide. Differences
in EC50 values among tested isolates were very low. MIC
values showed by isolates belonging to group B were
between 1 - 6 μg·ml−1 azoxystrobin, were slightly higher
than that of group A isolates. MIC values of group A
isolates wer between 0.1 - 1 μg·ml−1 azoxystrobin. It is
obvious that in most cases, the highest MIC value for
group A isolates corresponds to the lowest MIC value for
group B isolates.
DNA amplification with he primers RSCBF1 and t
Copyright © 2012 SciRes. AJPS
Observation on Baseline Sensitivity of Erysiphe necator Genetic Groups to Azoxystrobin
Copyright © 2012 SciRes. AJPS
1642
Table 1. Sensitivity of E. necator isolates belonging to the two genetic group to azoxystrobin.
Colonies diameter (mm) of 14-days-old colonies grown on leaves treated with
various concentrations (μg·ml−1) of azoxystrobin
Genetic group Isolate
0 0.1 0.3 1 3 6
EC50 MIC
X1 14 10 3 0 0 0 <0.3 1
X156 7.6 1 2 0 0 0 <0.1 1
X165 3.3 2 0 0 0 0 <0.3 0.3
X167 0 0 0 0 0 <0.1 0.1
X215 5.6 3 1 0 0 0 <0.3 1
X217 4.3 3 0 0 0 0 <0.3 0.3
X221 4.5 4.3 1.5 0 0 0 <0.3 1
X236 4.6 0 0 0 0 0 <0.1 0.1
X280 4.5 3 3 0 0 0 <1 1
X283 6.3 5.3 2.5 0 0 0 <0.3 1
A
“Flag-shoot”
X292 2.6 1.5 0 0 0 0 <0.3 0.3
G82 11 10 5 2 0 0 <0.3 3
X161 5 2 2 0 0 0 <0.1 1
X185 7.6 3 2.6 2 0 0 <0.1 3
X186 7.6 4.3 2 1 0 0 <0.3 3
X233 5.3 3 1.5 0 0 0 <0.3 1
X234 5 3.3 2 0 0 0 <0.3 1
X255 6.3 3 2.6 2.6 2.3 1 <0.1 >6
X294-A 6.3 1.5 4.3 0 0 0 <1 1
B
“Ascospore”
X296 5.6 4.5 2.3 1 1 0 0.3 6
RSCBR2, of mono-conidial isolate X34, yielded 2 bands
of 286 bp (StI) and 224 bp (StII) (Figure 1).
The StI and StII amplicons were sequenced and ana-
lyzed with FASTA sequences in Organelles Library of
EBI GenBank. Our results showed that StI, but not StII,
had a high similarity with the sequences of the mito-
chondrial cytb of other fungi (e.g. Erysiphe graminis,
Magnaporthe grisea, Venturia inaequalis, Podosphaera
fusca, Saccharomyces cerevisiae). The similarity within
the best 100 scores was 68% - 87.7% identity and 69% -
87.7% for the un-gapped alignment (Figure 2).
The StI nucleic acid sequence was translated into
amino acid sequence using the ExPASy (Expert Protein
Analysis System, Swiss Institute of Bioinformatics,
Switzerland; available at website http://us.expasy.org/).
The resulting amino acid sequence was aligned with
those of other fungi. StI proved to contain amino acid
sequence from 53 to 162 of the cytb gene, no mutations
at G143A and F129L were present (Figure 2).
The G82 isolates, were used in experiments for the
production of azoxystrobin resistant mutants. Periodical
transfer of conidia onto grapevine leaves treated with
various concentrations of azoxystrobin resulted in 12
putative mutants of G82 (Table 2). The most 6 promis-
ing putative resistant mutants (G82-a, G82-d, G82-h,
G82-i, G82-j and G82-k) were maintained on leaves
treated with azoxystrobin at various concentrations (0,
0.1, 0.3, 1, 5, 10, 20, 100 μg·ml−1). With the exception of
G82-i, EC50 values for the putative mutants were not
distinguishable from that of the parental G82 wild type
isolates (<0.1 μg·ml−1). Although MIC values for 5 of
them (G82-d and G82-j, MIC > 50 μg·ml−1; G82-h,
G82-i and G82-k, MIC = 20 μg·ml−1) were significantly
higher than the MIC of G82 (3 - 5 μg·ml−1) (Table 3).
4. Discussion
The work herein discussed made a partial sequence of the
gene of E. necator available; it will be helpful for further
Observation on Baseline Sensitivity of Erysiphe necator Genetic Groups to Azoxystrobin 1643
300 bp
A: St I
B: St II
Figure 1. Electrophoretic profiles obtained by amplification of E. necator DNA with the primers RSCBF1-RSCBR2, and se-
quences of St I (A) and St II (B).
Erysiphe necator (StI)
Erysiphe graminis (sensitive)
Erysiphe graminis (resistant)
Magnaporthe grisea
Saccharomyces cerevisiae
Venturia inaequalis
Podosphaera fusca (sensitive)
Podosphaera fusca (resistant)
Amino acid position
:FILMMATAFLGYVLPYGQMSLWGATVITNLMSAIPWIGQDIV
:FILMIVTAFLGYVLPYGHMSHWGATVITNLMSAIPWIGQDIV
:FILMIVTAFLGYVLPYGHMSHWAATVITNLMSAIPWIGQDIV
:LILMMAIGFLGYVLPYGQMSLWGATVITNLISAIPWIGQDIV
:FTLTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIV
:FILMIVTAFLGYVLPYGQMSLWGATVITNLMSAIPWIGQDIV
:--------FLGYGLPYGQMSLWGATV----------------
:--------FMGYGLPWGQMSLWAATV----------------
* * ** * ** * ******* **** * ***
:121 129 143 162
Figure 2. StI translation nucleic acid to amino acid (underlined) and multiple alignments with the cytochrome b gene frag-
ments containing the point mutations responsible of resistance to QoI-STARs in other fungi (in bold, position 129 and 143).
Table 2. Putative mutants of E. necat o r resistant to azoxystrobin obtained by selection of spontaneous mutations.
Colony transfer at 1-month intervals and fungicide concentration (μg·ml−1)
Starting strain
1st 2nd 3rd 4th 5th 6th
Recovered strains
5 G82-a
1 5 G82-b
5 10 G82-c
1 1 G82-d
1 10 G82-e
1 1 10 G82-f
1 1 G82-g
1 10 G82-h
1 1 10 100 G82-i
1 1 0 20 G82-j
1 10 20 G82-k
G82 0.1 1
1 1 10 30 G82-l
Copyright © 2012 SciRes. AJPS
Observation on Baseline Sensitivity of Erysiphe necator Genetic Groups to Azoxystrobin
1644
Table 3. Putative resistant mutants response to azoxystrobin.
Diameter (mm) of 14-days colony
Fungicide
concentration (μg·ml−1) G82 G82-a G82-d G82-h G82-i G82-j G82-k
0 11 12 9 11 4 5 12
0.1 5 5 4 3 3 3 5
0.3 4 4 3 - 3 4 2
1 3 4 2 2 4 2 -
5 0 0 3 - 3 0 2
10 0 0 3 2 4 1 1
20 0 0 0 0 0 0 0
50 0 0 3 0 0 2 0
EC50 <0.1 <0.1 <0.1 <0.1 10 - 20 0.3 - 1 <0.1
MIC 5 5 >50 20 20 >50 20
researches aiming at developing molecular methods use-
ful for field monitoring of the fungal resistance to fungi-
cides.
Attempts of obtaining laboratory mutants resistant to
QoI-STAR fungicides were only partially successful,
since only few mutants were obtained and usually they
displayed a low resistance level. Based on information
known in other fungi, mitochondrial resistance may be
unstable, since mitochondrial genome is present at a rela-
tively high number of copies, and it is very unlikely that
all of them carry resistance mutations [17].
An in vitro technique allowed to establish baseline
sensitivity of E. necator to azoxystrobin fungicide were
optimized. No significant differences in response to the
fungicides were observed among the tested isolates.
Nevertheless, differences were detected between group
A and group B isolates. The same behavior of the two
groups was observed in early study in response to triadi-
menol (DMIs) Fungicide [2].
The higher sensitivity to azoxystrobin of group A iso-
lates might play a role in their disappearance in vineyards
from June onwards, when intensive fungicides treatments,
including azoxystrobin, are routinely applied. Type A
isolates are usually collected on typical flag shoots early
in April, at the time of highest susceptibility of shoots to
powdery mildew, corresponding to the phenological
stage BBCH 13 - 16 (i.e. three to six unfolded leaves) [17,
18]. At this time, type A isolates have a higher chance to
colonise the forming buds in which they can remain until
the next season. This was further confirmed by the fact
that the incidence of flag shoots in a vineyard can be
predicted by assessing the extent of bud infection in the
preceding year [19]. The overwintering mode of group A
isolates determines their prevalent asexual reproduction.
This seems to be confirmed also by the low genotypic
diversity found in this group, and by the unbalanced dis-
tribution of the two mating type alleles that characterizes
this group [1,20,21]. If isolates of group A are present
only at the beginning of the growing season, they have a
reduced opportunity to be exposed to the fungicide pres-
sure. This fact, coupled with the absence of the gene re-
arrangement consequent to sexual reproduction, would
make group A isolates less likely to develop resistance.
In contrast, group B isolates develops later in the sea-
son and reproduce mostly sexually [22]. Thus, recombi-
nants would have a better opportunity of pyramiding
mutations necessary to build the fungicides resistance
that these isolates show, and that enables them to play a
primary role in epidemics.
Further studies are required for a better understanding
of E. necator resistance to azoxystrobin and for clarify-
ing the complex interactions that this trait appears to
have with population genetics of this pathogen. Ascer-
taining if the differential sensitivity of isolates of the two
genetic groups extends also to other fungicide groups,
identifying other factors that may favor one group over
the other, and understanding how all these factors can
affect the evolution of the epidemics, will be of great
help for a more efficient disease control.
5. Acknowledgements
The Author would like to thank Prof. Franco Faretra and
Dr. Monica Miazzi from Faculty of Plant Protection and
Microbiological Application, Bari University, for their
generous support and facilitating carrying out this work.
REFERENCES
[1] M. Miazzi, H. Hajjeh and F. Faretra, “Occurrence and
Distribution of Two Distinct Genetic Group in Population
of Erysiphe necator Schw. In Southern Italy,” Journal of
Plant Pathology, Vol. 90, No. 3, 2008, pp. 563-573.
Copyright © 2012 SciRes. AJPS
Observation on Baseline Sensitivity of Erysiphe necator Genetic Groups to Azoxystrobin 1645
[2] M. Miazzi and H. R. Hajjeh, “Differential Sensitivity to
Triadimenol of Erysiphe necator Isolates Belonging to
Different Genetic Groups,” Journal of Plant Pathology,
Vol. 93, No. 3, 2011, pp. 729-735.
[3] S. P. Heaney, A. A. Hall, S. A. Davies and G. Olaya,
“Resistance to Fungicides in the Qo1-STAR Cross-Re-
sistance Group: Current Perspectives,” Proceedings of
Brighton Crop Protection Conference-Pests and Diseases,
Vol. 2, 2000, pp. 755-762.
[4] H. Ishii, “QoI Fungicide Resistance: Current Status and
the Problems Associated with DNA-Based Monitoring,”
In: U. Gisi, I. Chet and M. L. Gullino, Eds., Recent De-
velopments in Management of Plant Diseases, Plant Pa-
thology in the 21st Century, Springer, Dordnecht, 2009,
pp. 37-45.
[5] D. Zheng, G. Olaya and W. Koller, “Characterization of
Laboratory Mutants of Venturia inaequalis Resistant to
Strobilurins-Related Fungicides Kresoxim-Methyl,” Cur-
rent Genetics, Vol. 38, 2000, pp. 148-155.
doi:10.1007/s002940000147
[6] S. Baumler, H. Sierotzki, U. Gisi, V. Mohler, F. G. Fel-
senstein and G. Schwarz, “Evaluation of Erysiphe gra-
minis f. sp. tritici Field Isolates for Resistance to Stro-
bilurin Fungicides with Different SNP Detection Sys-
tems,” Pest Management Science, Vol. 59, No. 3, 2003,
pp. 310-314. doi:10.1002/ps.639
[7] P. M. Wood and D. W. Hollomon, “A Critical Evaluation
of the Role of Alternative Oxidase in the Performance of
Strobilurin and Related Fungicides Acting at the Qo Site
of Complex III,” Pest Management Science, Vol. 59, No.
5, 2003, pp. 499-511. doi:10.1002/ps.655
[8] H. Sierotzki, R. Frey, J. Wullschleger, S. Palermo, S.
Karli, J. Godwin and U. Gisi, “Cytochrome b Gene Se-
quence and Structure of Pyrenophora teres and P. tritici-
repentis and Implications for QoI Resistance,” Pest
Management Science, Vol. 63, No. 3, 2007, pp. 225-233.
doi:10.1002/ps.1330
[9] M. Miguez, C. Reeve, P. M. Wood and D. W. Hollomon,
“Alternative Oxidase Reduces the Sensitivity of Mycos-
phaerella graminicola to QoI Fungicides,” Pest Man-
agement Science, Vol. 60, No. 1, 2004, pp. 3-7.
doi:10.1002/ps.837
[10] D. Fernández-Ortuño, J. A. Torés, A. de Vicente and A.
Pérez-García, “The QoI Fungicides, the Rise and Fall of a
Successful Class of Agricultural Fungicides,” In: O.
Carisse, Ed., Fungicides, Janeza Trdine, Rijeka, 2010, pp.
203-220. doi:10.5772/13205
[11] FRAC, “International FRAC QoI Working Group Minutes
2011, All Crops,” Fungicide Resistance Action Com-
mittee, 2011.
[12] P. Hoffmann, I. Fuzi and F. Viranyi, “Indirect Effect of
Fungicide Treatments on Chasmothecia of Erysiphe ne-
cator Schwein Overwintering on Grapevine Bark,” Plant
Protection Science, Vol. 48, No. 1, 2012, pp. 21-30.
[13] J. F. Colcol, “Fungicide Sensitivity of Erysiphe necator
and Plasmopara viticola from Virginia and Nearby
States,” M.Sc. Thesis, Virginia Polytechnic Institute and
State University, Blacksburg, 2008.
[14] A. Baudoin, G. Olaya, F. Delmotte, J. F. Colcol and H.
Sierotzki, “QoI Resistance of Plasmopara viticola and
Erysiphe necator in the mid-Atlantic United States,” 2008.
http://www.plantmanagementnetwork.org/pub/php/resear
ch/2008/qoi/
[15] M. Miazzi, P. Natale, S. Pollastro and F. Faretra, “Han-
dling of the Biotrophic Pathogen Uncinula necator
(Schw.) Burr. under Laboratory Conditions and Obser-
vations on Its Mating System,” Journal of Plant Pathol-
ogy, Vol. 78, 1997, pp. 71-77.
[16] H. Ishii, B. A. Fraaije, T. Sugiyama, K. Noguchi, K. Ni-
shimura, T. Takeda, T. Amano and D. W. Hollomon,
“Occurrence and Molecular Characterization of Strobi-
lurin Resistance in Cucumber Powdery Mildew and
Downy Mildew,” Phytopathology, Vol. 91, No. 12, 2001,
pp. 1166-1171. doi:10.1094/PHYTO.2001.91.12.1166
[17] A. Rügner, J. Rumbolz, B. Huber, G. Bleyer, U. Gisi, H.
Kassemey er and R. Guggenheim, “Formation of Over-
wintering Structures of Uncinula necator and Colonisa-
tion of Grapevine under Field Conditions,” Plant Pathol-
ogy, Vol. 51, No. 3, 2002, pp. 322-330.
doi:10.1046/j.1365-3059.2002.00694.x
[18] J. Rumbolz and W. D. Gubler, “Susceptibility of Grape-
vine Buds to Infection by Powdery Mildew Erysiphe ne-
cator,” Plant Pathology, Vol. 54, No. 4, 2005, pp. 535-
548. doi:10.1111/j.1365-3059.2005.01212.x
[19] M. R. Rademacher, J. Rumbolz and W. D. Gubler, “Evi-
dence for Early Colonisation of Grape Buds by Uncinula
necator,” Phytopathology, Vol. 91, 2002, p. S74.
[20] J. P. Peros, T. H. Nguyen, C. Troulet, C. Michel-Romiti
and L. Notteghem, “Assessment of Powdery Mildew Re-
sistance of Grape and Erysiphe necator Pathogenicity
Using a Laboratory Assay,” Vitis, Vol. 45, 2006, pp. 29-
36.
[21] J. Montarry, P. Cartolaro, S. Richard-Cervera and F.
Delmotte, “Spatio-Temporal Distribution of Erysiphe
necator Genetic Groups and Their Relationship with
Disease Levels in Vineyards,” European Journal Plant
Pathology, Vol. 123, No. 1, 2009, pp. 61-70.
doi:10.1007/s10658-008-9343-9
[22] J. Montarry, P. Cartolaro, F. Delmotte, J. Jolivet and L.
Willocquet, “Genetic Structure and s Aggressiveness of
Erysiphe necator Populations during Grapevine Powdery
Mildew Epidemics,” Applied and Environmental Micro-
biology, Vol. 78, 2008, pp. 6327-6332.
doi:10.1128/AEM.01200-08
Copyright © 2012 SciRes. AJPS